SCOP 1.75: Domain d1iida1: 1iid A:34-218

Lineage for d1iida1 (1iid A:34-218)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries)

8. Domain d1iida1: 1iid A:34-218 [62426]
   complex with s-(2-oxo)pentadecyl-CoA and the octapeptide

Details for d1iida1

PDB Entry: 1iid, 2.5 Å

PDB Description: Crystal Structure of Saccharomyces cerevisiae N-myristoyltransferase with Bound S-(2-oxo)pentadecylCoA and the Octapeptide GLYASKLA

PDB Compounds: (A:) Peptide N-myristoyltransferase

SCOP Domain Sequences for d1iida1:

Sequence; same for both SEQRES and ATOM records:

>d1iida1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
amkdhkfwrtqpvkdfdekvveegpidkpktpedisdkplpllssfewcsidvdnkkqle
dvfvllnenyvedrdagfrfnytkeffnwalkspgwkkdwhigvrvketqklvafisaip
vtlgvrgkqvpsveinflcvhkqlrskrltpvlikeitrrvnkcdiwhalytagivlpap
vstcr

Timeline for d1iida1:

• d1iida1 first appeared in SCOP 1.57
  
• d1iida1 appears in SCOP 1.73
  
• d1iida1 appears in SCOPe 2.01
  
• d1iida1 appears in the current release, SCOPe 2.08