SCOPe 2.05: Domain d1ii8.1: 1ii8 A:,B:

Lineage for d1ii8.1 (1ii8 A:,B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Rad50 [52691] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [52692] (4 PDB entries)

8. Domain d1ii8.1: 1ii8 A:,B: [62417]
   N- and C-terminal subdomains; include a small fragment of the middle coiled coil domain
   complexed with po4

Details for d1ii8.1

PDB Entry: 1ii8, 3.02 Å

PDB Description: Crystal structure of the P. furiosus Rad50 ATPase domain

PDB Compounds: (A:) rad50 abc-ATPase, (B:) rad50 abc-ATPase

SCOPe Domain Sequences for d1ii8.1:

Sequence; same for both SEQRES and ATOM records:

>g1ii8.1 c.37.1.12 (A:,B:) Rad50 {Pyrococcus furiosus [TaxId: 2261]}
mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde
ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais
afmeklipyniflnaiyirqgqidailesdearekvvrevlnldkfetaykklselkkti
nnrikeyrdilarteXrervkkeikdlekakdfteeliekvkkykalareaalskigela
seifaeftegkysevvvraeenkvrlfvvwegkerpltflsggerialglafrlamslyl
ageisllildeptpyldeerrrklitimerylkkipqvilvshdeelkdaadhvirisle
ngsskvevvs

Timeline for d1ii8.1:

• d1ii8.1 first appeared in SCOP 1.57
  
• d1ii8.1 appears in SCOPe 2.04
  
• d1ii8.1 appears in SCOPe 2.06
  
• d1ii8.1 appears in the current release, SCOPe 2.08