SCOPe 2.04: Domain d1ii7b_: 1ii7 B:

Lineage for d1ii7b_ (1ii7 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
   contains C-terminal alpha/beta subdomain

6. Protein Mre11 [64428] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries)
   Uniprot Q8U1N9

8. Domain d1ii7b_: 1ii7 B: [62416]
   complexed with da, mn, po4, so4

Details for d1ii7b_

PDB Entry: 1ii7, 2.2 Å

PDB Description: Crystal structure of P. furiosus Mre11 with manganese and dAMP

PDB Compounds: (B:) Mre11 nuclease

SCOPe Domain Sequences for d1ii7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ii7b_ d.159.1.4 (B:) Mre11 {Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwr

Timeline for d1ii7b_:

• d1ii7b_ first appeared in SCOP 1.57
  
• d1ii7b_ appears in SCOPe 2.03
  
• d1ii7b_ appears in SCOPe 2.05
  
• d1ii7b_ appears in the current release, SCOPe 2.08