Lineage for d1ii5a_ (1ii5 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250728Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 250729Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 250730Family c.94.1.1: Phosphate binding protein-like [53851] (19 proteins)
  6. 250795Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 250834Species Synechocystis sp., GluR0 [TaxId:1143] [64192] (3 PDB entries)
  8. 250835Domain d1ii5a_: 1ii5 A: [62412]
    complexed with glu

Details for d1ii5a_

PDB Entry: 1ii5 (more details), 1.6 Å

PDB Description: crystal structure of the glur0 ligand binding core complex with l- glutamate

SCOP Domain Sequences for d1ii5a_:

Sequence, based on SEQRES records: (download)

>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0}
gsamalkvgvvgnppfvfygegknaaftgisldvwravaesqkwnseyvrqnsisagita
vaegeldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkeva
vvrdttavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlev
teirvslepygfvlkensplqktinvemlnllysrviaefterwlg

Sequence, based on observed residues (ATOM records): (download)

>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0}
gsamalkvgvvgnppfvfygaftgisldvwravaesqkwnseyvrqnsisagitavaege
ldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdt
tavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirv
slepygfvlkensplqktinvemlnllysrviaefterwlg

SCOP Domain Coordinates for d1ii5a_:

Click to download the PDB-style file with coordinates for d1ii5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ii5a_: