SCOP 1.67: Domain d1ii4h1: 1ii4 H:150-250

Lineage for d1ii4h1 (1ii4 H:150-250)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (32 proteins)
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (5 PDB entries)
Domain d1ii4h1: 1ii4 H:150-250 [62410]
Other proteins in same PDB: d1ii4a_, d1ii4b_, d1ii4c_, d1ii4d_

Details for d1ii4h1

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1ii4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii4h1 b.1.1.4 (H:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOP Domain Coordinates for d1ii4h1:

Click to download the PDB-style file with coordinates for d1ii4h1.
(The format of our PDB-style files is described here.)

Timeline for d1ii4h1: