SCOP 1.73: Domain d1ii4g2: 1ii4 G:251-361

Lineage for d1ii4g2 (1ii4 G:251-361)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (6 PDB entries)

8. Domain d1ii4g2: 1ii4 G:251-361 [62409]
   Other proteins in same PDB: d1ii4a_, d1ii4b_, d1ii4c_, d1ii4d_

Details for d1ii4g2

PDB Entry: 1ii4, 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

PDB Compounds: (G:) Fibroblast growth factor receptor 2

SCOP Domain Sequences for d1ii4g2:

Sequence, based on SEQRES records:

>d1ii4g2 b.1.1.4 (G:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rwphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlp

Sequence, based on observed residues (ATOM records):

>d1ii4g2 b.1.1.4 (G:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rwphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdk
eievlyirnvtfedageytclagnsigisfhsawltvlp

Timeline for d1ii4g2:

• d1ii4g2 first appeared in SCOP 1.57
  
• d1ii4g2 appears in SCOP 1.71
  
• d1ii4g2 appears in SCOP 1.75
  
• d1ii4g2 appears in the current release, SCOPe 2.08