Lineage for d1ii4f1 (1ii4 F:150-250)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104758Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 104772Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)
  8. 104793Domain d1ii4f1: 1ii4 F:150-250 [62406]
    Other proteins in same PDB: d1ii4a_, d1ii4b_, d1ii4c_, d1ii4d_

Details for d1ii4f1

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1ii4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii4f1 b.1.1.4 (F:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOP Domain Coordinates for d1ii4f1:

Click to download the PDB-style file with coordinates for d1ii4f1.
(The format of our PDB-style files is described here.)

Timeline for d1ii4f1: