Lineage for d1ii4d_ (1ii4 D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669060Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 669061Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 669062Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 669145Protein Basic FGF (FGF2) [50355] (1 species)
  7. 669146Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)
  8. 669169Domain d1ii4d_: 1ii4 D: [62403]
    Other proteins in same PDB: d1ii4e1, d1ii4e2, d1ii4f1, d1ii4f2, d1ii4g1, d1ii4g2, d1ii4h1, d1ii4h2
    mutant

Details for d1ii4d_

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
PDB Compounds: (D:) heparin-binding growth factor 2

SCOP Domain Sequences for d1ii4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii4d_ b.42.1.1 (D:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
pgqkailflpmsak

SCOP Domain Coordinates for d1ii4d_:

Click to download the PDB-style file with coordinates for d1ii4d_.
(The format of our PDB-style files is described here.)

Timeline for d1ii4d_: