Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein Basic FGF (FGF2) [50355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50356] (19 PDB entries) |
Domain d1ii4c_: 1ii4 C: [62402] Other proteins in same PDB: d1ii4e1, d1ii4e2, d1ii4f1, d1ii4f2, d1ii4g1, d1ii4g2, d1ii4h1, d1ii4h2 mutant |
PDB Entry: 1ii4 (more details), 2.7 Å
SCOPe Domain Sequences for d1ii4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ii4c_ b.42.1.1 (C:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg pgqkailflpmsak
Timeline for d1ii4c_: