Lineage for d1ii4c_ (1ii4 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061695Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2061696Species Human (Homo sapiens) [TaxId:9606] [50356] (19 PDB entries)
  8. 2061721Domain d1ii4c_: 1ii4 C: [62402]
    Other proteins in same PDB: d1ii4e1, d1ii4e2, d1ii4f1, d1ii4f2, d1ii4g1, d1ii4g2, d1ii4h1, d1ii4h2
    mutant

Details for d1ii4c_

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
PDB Compounds: (C:) heparin-binding growth factor 2

SCOPe Domain Sequences for d1ii4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii4c_ b.42.1.1 (C:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
pgqkailflpmsak

SCOPe Domain Coordinates for d1ii4c_:

Click to download the PDB-style file with coordinates for d1ii4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ii4c_: