Lineage for d1ii4a_ (1ii4 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111052Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 111053Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 111110Protein Basic FGF (FGF2) [50355] (1 species)
  7. 111111Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)
  8. 111131Domain d1ii4a_: 1ii4 A: [62400]
    Other proteins in same PDB: d1ii4e1, d1ii4e2, d1ii4f1, d1ii4f2, d1ii4g1, d1ii4g2, d1ii4h1, d1ii4h2

Details for d1ii4a_

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1ii4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii4a_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens)}
fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
pgqkailflpmsak

SCOP Domain Coordinates for d1ii4a_:

Click to download the PDB-style file with coordinates for d1ii4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ii4a_: