Lineage for d1ihua1 (1ihu A:1-296)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111842Protein Arsenite-translocating ATPase ArsA [52668] (1 species)
    Duplication: consists of two domains of this fold arranged as the NIP subunits in the dimer
  7. 2111843Species Escherichia coli [TaxId:562] [52669] (4 PDB entries)
  8. 2111844Domain d1ihua1: 1ihu A:1-296 [62394]
    Other proteins in same PDB: d1ihua3
    complexed with adp, af3, cd, cl, mg, tas

Details for d1ihua1

PDB Entry: 1ihu (more details), 2.15 Å

PDB Description: crystal structure of the escherichia coli arsenite-translocating atpase in complex with mg-adp-alf3
PDB Compounds: (A:) arsenical pump-driving ATPase

SCOPe Domain Sequences for d1ihua1:

Sequence, based on SEQRES records: (download)

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}
mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp

Sequence, based on observed residues (ATOM records): (download)

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}
mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
deftglltdaslltrfdhiifdtaptghtirllqlpgawssfiasclgpmaglekqreqy
ayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpkteaand
tlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp

SCOPe Domain Coordinates for d1ihua1:

Click to download the PDB-style file with coordinates for d1ihua1.
(The format of our PDB-style files is described here.)

Timeline for d1ihua1: