Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Arsenite-translocating ATPase ArsA [52668] (1 species) Duplication: consists of two domains of this fold arranged as the NIP subunits in the dimer |
Species Escherichia coli [TaxId:562] [52669] (4 PDB entries) |
Domain d1ihua1: 1ihu A:1-296 [62394] Other proteins in same PDB: d1ihua3 complexed with adp, af3, cd, cl, mg, tas |
PDB Entry: 1ihu (more details), 2.15 Å
SCOPe Domain Sequences for d1ihua1:
Sequence, based on SEQRES records: (download)
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf deftglltdaslltrfdhiifdtaptghtirllqlpgawssfiasclgpmaglekqreqy ayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpkteaand tlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqp
Timeline for d1ihua1: