SCOPe 2.04: Domain d1ihnb_: 1ihn B:

Lineage for d1ihnb_ (1ihn B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)
   automatically mapped to Pfam PF04430

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical protein MT938 (MTH938) [64078] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry)

8. Domain d1ihnb_: 1ihn B: [62389]
   complexed with cl

Details for d1ihnb_

PDB Entry: 1ihn, 2.2 Å

PDB Description: mt938

PDB Compounds: (B:) hypothetical protein MTH938

SCOPe Domain Sequences for d1ihnb_:

Sequence; same for both SEQRES and ATOM records:

>d1ihnb_ c.103.1.1 (B:) Hypothetical protein MT938 (MTH938) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc

Timeline for d1ihnb_:

• d1ihnb_ first appeared in SCOP 1.57
  
• d1ihnb_ appears in SCOPe 2.03
  
• d1ihnb_ appears in SCOPe 2.05
  
• d1ihnb_ appears in the current release, SCOPe 2.08, called d1ihnb1