Lineage for d1ihnb_ (1ihn B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128654Fold c.103: Hypothetical protein MT938 (MTH938) [64075] (1 superfamily)
  4. 128655Superfamily c.103.1: Hypothetical protein MT938 (MTH938) [64076] (1 family) (S)
  5. 128656Family c.103.1.1: Hypothetical protein MT938 (MTH938) [64077] (1 protein)
  6. 128657Protein Hypothetical protein MT938 (MTH938) [64078] (1 species)
  7. 128658Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry)
  8. 128660Domain d1ihnb_: 1ihn B: [62389]

Details for d1ihnb_

PDB Entry: 1ihn (more details), 2.2 Å

PDB Description: mt938

SCOP Domain Sequences for d1ihnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihnb_ c.103.1.1 (B:) Hypothetical protein MT938 (MTH938) {Archaeon Methanobacterium thermoautotrophicum}
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc

SCOP Domain Coordinates for d1ihnb_:

Click to download the PDB-style file with coordinates for d1ihnb_.
(The format of our PDB-style files is described here.)

Timeline for d1ihnb_: