Lineage for d1ihnb_ (1ihn B:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.103: Hypothetical protein MT938 (MTH938) [64075] (1 superfamily) Superfamily c.103.1: Hypothetical protein MT938 (MTH938) [64076] (1 family) 
Family c.103.1.1: Hypothetical protein MT938 (MTH938) [64077] (1 protein) Protein Hypothetical protein MT938 (MTH938) [64078] (1 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry) 
Domain d1ihnb_: 1ihn B: [62389]
Details for d1ihnb_
PDB Entry: 1ihn (more details), 2.2 Å
PDB Description: mt938
SCOP Domain Sequences for d1ihnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihnb_ c.103.1.1 (B:) Hypothetical protein MT938 (MTH938) {Archaeon Methanobacterium thermoautotrophicum}
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
SCOP Domain Coordinates for d1ihnb_:
Click to download the PDB-style file with coordinates for d1ihnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihnb_:
- d1ihnb_ is new in SCOP 1.57
- d1ihnb_ appears in SCOP 1.59
- d1ihnb_ appears in the current release, SCOPe 2.08, called d1ihnb1
View in 3D
