SCOPe 2.07: Domain d1ihna1: 1ihn A:11-121

Lineage for d1ihna1 (1ihn A:11-121)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)
   automatically mapped to Pfam PF04430

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical protein MT938 (MTH938) [64078] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry)

8. Domain d1ihna1: 1ihn A:11-121 [62388]
   Other proteins in same PDB: d1ihna2, d1ihnb2
   complexed with cl

Details for d1ihna1

PDB Entry: 1ihn, 2.2 Å

PDB Description: mt938

PDB Compounds: (A:) hypothetical protein MTH938

SCOPe Domain Sequences for d1ihna1:

Sequence; same for both SEQRES and ATOM records:

>d1ihna1 c.103.1.1 (A:11-121) Hypothetical protein MT938 (MTH938) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleelleekp
esiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc

Timeline for d1ihna1:

• d1ihna1 first appeared in SCOP 1.57, called d1ihna_
  
• d1ihna1 appears in SCOPe 2.06
  
• d1ihna1 appears in the current release, SCOPe 2.08