Lineage for d1ihna_ (1ihn A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847842Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 847843Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
  5. 847844Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 847848Protein Hypothetical protein MT938 (MTH938) [64078] (1 species)
  7. 847849Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry)
  8. 847850Domain d1ihna_: 1ihn A: [62388]

Details for d1ihna_

PDB Entry: 1ihn (more details), 2.2 Å

PDB Description: mt938
PDB Compounds: (A:) hypothetical protein MTH938

SCOP Domain Sequences for d1ihna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihna_ c.103.1.1 (A:) Hypothetical protein MT938 (MTH938) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc

SCOP Domain Coordinates for d1ihna_:

Click to download the PDB-style file with coordinates for d1ihna_.
(The format of our PDB-style files is described here.)

Timeline for d1ihna_: