Class b: All beta proteins [48724] (144 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) |
Family b.121.4.3: Caliciviridae-like VP [88637] (1 protein) |
Protein Calicivirus capsid protein [63691] (1 species) includes the P (protruding) domain of complex beta-structure containing a beta-barrel similar to the second domain of EF-TU |
Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry) |
Domain d1ihmc_: 1ihm C: [62387] |
PDB Entry: 1ihm (more details), 3.4 Å
SCOP Domain Sequences for d1ihmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihmc_ b.121.4.3 (C:) Calicivirus capsid protein {Norwalk virus} dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs rfyqlkpvgtas
Timeline for d1ihmc_: