SCOP 1.67: Domain d1ihma_: 1ihm A:

Lineage for d1ihma_ (1ihm A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.3: Caliciviridae-like VP [88637] (1 protein)

6. Protein Calicivirus capsid protein [63691] (1 species)
   includes the P (protruding) domain of complex beta-structure containing a beta-barrel similar to the second domain of EF-TU

7. Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry)

8. Domain d1ihma_: 1ihm A: [62385]

Details for d1ihma_

PDB Entry: 1ihm, 3.4 Å

PDB Description: crystal structure analysis of norwalk virus capsid

SCOP Domain Sequences for d1ihma_:

Sequence; same for both SEQRES and ATOM records:

>d1ihma_ b.121.4.3 (A:) Calicivirus capsid protein {Norwalk virus}
dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
rfyqlkpvgtas

Timeline for d1ihma_:

• d1ihma_ first appeared in SCOP 1.57
  
• d1ihma_ appears in SCOP 1.65
  
• d1ihma_ appears in SCOP 1.69
  
• d1ihma_ appears in the current release, SCOPe 2.08