Lineage for d1ihma_ (1ihm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2075995Family b.121.4.3: Caliciviridae-like VP [88637] (1 protein)
  6. 2075996Protein Calicivirus capsid protein [63691] (1 species)
    includes the P (protruding) domain of complex beta-structure containing a beta-barrel similar to the second domain of EF-TU
  7. 2075997Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry)
  8. 2075998Domain d1ihma_: 1ihm A: [62385]

Details for d1ihma_

PDB Entry: 1ihm (more details), 3.4 Å

PDB Description: crystal structure analysis of norwalk virus capsid
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d1ihma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihma_ b.121.4.3 (A:) Calicivirus capsid protein {Norwalk virus [TaxId: 11983]}
dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
rfyqlkpvgtas

SCOPe Domain Coordinates for d1ihma_:

Click to download the PDB-style file with coordinates for d1ihma_.
(The format of our PDB-style files is described here.)

Timeline for d1ihma_: