Lineage for d1ihka_ (1ihk A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401478Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 2401479Species Human (Homo sapiens) [TaxId:9606] [63782] (3 PDB entries)
  8. 2401480Domain d1ihka_: 1ihk A: [62384]
    complexed with po4

Details for d1ihka_

PDB Entry: 1ihk (more details), 2.2 Å

PDB Description: crystal structure of fibroblast growth factor 9 (fgf9)
PDB Compounds: (A:) glia-activating factor

SCOPe Domain Sequences for d1ihka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihka_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]}
tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd
sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt
pregtrtkrhqkfthflprpvdpdkvpelykdilsqs

SCOPe Domain Coordinates for d1ihka_:

Click to download the PDB-style file with coordinates for d1ihka_.
(The format of our PDB-style files is described here.)

Timeline for d1ihka_: