Lineage for d1ihka_ (1ihk A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins) 
Protein Fibroblast growth factor 9, FGF9 [63781] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries) 
Domain d1ihka_: 1ihk A: [62384]
Details for d1ihka_
PDB Entry: 1ihk (more details), 2.2 Å
PDB Description: crystal structure of fibroblast growth factor 9 (fgf9)
SCOP Domain Sequences for d1ihka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihka_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)}
tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd
sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt
pregtrtkrhqkfthflprpvdpdkvpelykdilsqs
SCOP Domain Coordinates for d1ihka_:
Click to download the PDB-style file with coordinates for d1ihka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihka_:
- d1ihka_ is new in SCOP 1.57
- d1ihka_ appears in SCOP 1.59
- d1ihka_ appears in the current release, SCOPe 2.08
View in 3D