![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
![]() | Protein Fibroblast growth factor 9, FGF9 [63781] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63782] (3 PDB entries) |
![]() | Domain d1ihka_: 1ihk A: [62384] complexed with po4 |
PDB Entry: 1ihk (more details), 2.2 Å
SCOPe Domain Sequences for d1ihka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihka_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]} tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt pregtrtkrhqkfthflprpvdpdkvpelykdilsqs
Timeline for d1ihka_: