SCOPe 2.05: Domain d1ihja_: 1ihj A:

Lineage for d1ihja_ (1ihj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Inad [63756] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63757] (1 PDB entry)

8. Domain d1ihja_: 1ihj A: [62382]
   first PDZ domain; complexed with a Norpa C-terminal peptide

Details for d1ihja_

PDB Entry: 1ihj, 1.8 Å

PDB Description: Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA C-terminal peptide

PDB Compounds: (A:) InaD

SCOPe Domain Sequences for d1ihja_:

Sequence; same for both SEQRES and ATOM records:

>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gelihmvtldktgkksfgicivrgevkdspntkttgifikgivpdspahlcgrlkvgdri
lslngkdvrnsteqavidlikeadfkieleiqtf

Timeline for d1ihja_:

• d1ihja_ first appeared in SCOP 1.57
  
• d1ihja_ appears in SCOPe 2.04
  
• d1ihja_ appears in SCOPe 2.06
  
• d1ihja_ appears in the current release, SCOPe 2.08