![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Cyclophilin 40 isomerase domain [63814] (1 species) the other domain is formed by TPR repeats |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries) |
![]() | Domain d1ihga2: 1ihg A:2-196 [62381] Other proteins in same PDB: d1ihga1 complexed with gol |
PDB Entry: 1ihg (more details), 1.8 Å
SCOPe Domain Sequences for d1ihga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec gelkegddwgifpkd
Timeline for d1ihga2: