SCOP 1.69: Domain d1ihga2: 1ihg A:2-196

Lineage for d1ihga2 (1ihg A:2-196)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin 40 isomerase domain [63814] (1 species)
   the other domain is formed by TPR repeats

7. Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries)

8. Domain d1ihga2: 1ihg A:2-196 [62381]
   Other proteins in same PDB: d1ihga1

Details for d1ihga2

PDB Entry: 1ihg, 1.8 Å

PDB Description: Bovine Cyclophilin 40, monoclinic form

SCOP Domain Sequences for d1ihga2:

Sequence; same for both SEQRES and ATOM records:

>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus)}
shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
gelkegddwgifpkd

Timeline for d1ihga2:

• d1ihga2 first appeared in SCOP 1.57
  
• d1ihga2 appears in SCOP 1.67
  
• d1ihga2 appears in SCOP 1.71
  
• d1ihga2 appears in the current release, SCOPe 2.08