Lineage for d1ihga2 (1ihg A:2-196)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232982Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 232983Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 232984Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 233094Protein Cyclophilin 40 isomerase domain [63814] (1 species)
    the other domain is formed by TPR repeats
  7. 233095Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries)
  8. 233096Domain d1ihga2: 1ihg A:2-196 [62381]
    Other proteins in same PDB: d1ihga1
    complexed with gol

Details for d1ihga2

PDB Entry: 1ihg (more details), 1.8 Å

PDB Description: Bovine Cyclophilin 40, monoclinic form

SCOP Domain Sequences for d1ihga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus)}
shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
gelkegddwgifpkd

SCOP Domain Coordinates for d1ihga2:

Click to download the PDB-style file with coordinates for d1ihga2.
(The format of our PDB-style files is described here.)

Timeline for d1ihga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ihga1