SCOPe 2.04: Domain d1ihga1: 1ihg A:197-365

Lineage for d1ihga1 (1ihg A:197-365)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Cyclophilin 40 [63618] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries)

8. Domain d1ihga1: 1ihg A:197-365 [62380]
   Other proteins in same PDB: d1ihga2
   complexed with gol

Details for d1ihga1

PDB Entry: 1ihg, 1.8 Å

PDB Description: Bovine Cyclophilin 40, monoclinic form

PDB Compounds: (A:) Cyclophilin 40

SCOPe Domain Sequences for d1ihga1:

Sequence; same for both SEQRES and ATOM records:

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}
gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs
raaaedadgaklqpvalscvlnigacklkmsdwqgavdsclealeidpsntkalyrraqg
wqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdkekaay

Timeline for d1ihga1:

• d1ihga1 first appeared in SCOP 1.57
  
• d1ihga1 appears in SCOPe 2.03
  
• d1ihga1 appears in SCOPe 2.05
  
• d1ihga1 appears in the current release, SCOPe 2.08