Class a: All alpha proteins [46456] (202 folds) |
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (2 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (9 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Cyclophilin 40 [63618] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries) |
Domain d1ihga1: 1ihg A:197-365 [62380] Other proteins in same PDB: d1ihga2 complexed with gol |
PDB Entry: 1ihg (more details), 1.8 Å
SCOP Domain Sequences for d1ihga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus)} gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs raaaedadgaklqpvalscvlnigacklkmsdwqgavdsclealeidpsntkalyrraqg wqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdkekaay
Timeline for d1ihga1: