Lineage for d1ihga1 (1ihg A:197-365)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360030Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 360031Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (9 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 360032Protein Cyclophilin 40 [63618] (1 species)
  7. 360033Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries)
  8. 360034Domain d1ihga1: 1ihg A:197-365 [62380]
    Other proteins in same PDB: d1ihga2
    complexed with gol

Details for d1ihga1

PDB Entry: 1ihg (more details), 1.8 Å

PDB Description: Bovine Cyclophilin 40, monoclinic form

SCOP Domain Sequences for d1ihga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus)}
gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs
raaaedadgaklqpvalscvlnigacklkmsdwqgavdsclealeidpsntkalyrraqg
wqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdkekaay

SCOP Domain Coordinates for d1ihga1:

Click to download the PDB-style file with coordinates for d1ihga1.
(The format of our PDB-style files is described here.)

Timeline for d1ihga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ihga2