SCOPe 2.03: Domain d1ih8a_: 1ih8 A:

Lineage for d1ih8a_ (1ih8 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)

8. Domain d1ih8a_: 1ih8 A: [62377]
   complexed with apc, mg

Details for d1ih8a_

PDB Entry: 1ih8, 1.9 Å

PDB Description: NH3-dependent NAD+ Synthetase from Bacillus subtilis Complexed with AMP-CPP and Mg2+ ions.

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1ih8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ih8a_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

Timeline for d1ih8a_:

• d1ih8a_ first appeared in SCOP 1.57
  
• d1ih8a_ appears in SCOPe 2.02
  
• d1ih8a_ appears in SCOPe 2.04
  
• d1ih8a_ appears in the current release, SCOPe 2.08