Lineage for d1ih8a_ (1ih8 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) 
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (3 proteins) Protein NH3-dependent NAD+-synthetase [52406] (1 species) Species Bacillus subtilis [TaxId:1423] [52407] (6 PDB entries) 
Domain d1ih8a_: 1ih8 A: [62377]
Details for d1ih8a_
PDB Entry: 1ih8 (more details), 1.9 Å
PDB Description: NH3-dependent NAD+ Synthetase from Bacillus subtilis Complexed with AMP-CPP and Mg2+ ions.
SCOP Domain Sequences for d1ih8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ih8a_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
SCOP Domain Coordinates for d1ih8a_:
Click to download the PDB-style file with coordinates for d1ih8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ih8a_:
- d1ih8a_ is new in SCOP 1.57
- d1ih8a_ appears in SCOP 1.59
- d1ih8a_ appears in the current release, SCOPe 2.08
View in 3D
