SCOP 1.65: Domain d1ih7a1: 1ih7 A:1-375

Lineage for d1ih7a1 (1ih7 A:1-375)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)

6. Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species)
   elaborated with additional structures and the N-terminal subdomain
   the N-terminal subdomain of archaeal polymerases contains ferredoxin-like fold

7. Species Bacteriophage RB69 [TaxId:12353] [53127] (5 PDB entries)

8. Domain d1ih7a1: 1ih7 A:1-375 [62375]
   Other proteins in same PDB: d1ih7a2
   complexed with gmp, k

Details for d1ih7a1

PDB Entry: 1ih7, 2.21 Å

PDB Description: High-Resolution Structure of Apo RB69 DNA Polymerase

SCOP Domain Sequences for d1ih7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Timeline for d1ih7a1:

• d1ih7a1 first appeared in SCOP 1.57
  
• d1ih7a1 appears in SCOP 1.63
  
• d1ih7a1 appears in SCOP 1.67
  
• d1ih7a1 appears in the current release, SCOPe 2.08