| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) ![]() |
| Family f.19.1.1: Aquaporin-like [56895] (4 proteins) duplication: consist of two similar structural parts |
| Protein Aquaporin-1 [56896] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries) |
| Domain d1ih5a_: 1ih5 A: [62374] |
PDB Entry: 1ih5 (more details), 3.7 Å
SCOP Domain Sequences for d1ih5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ih5a_ f.19.1.1 (A:) Aquaporin-1 {Human (Homo sapiens) [TaxId: 9606]}
lfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsvg
hisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrnd
ladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidytg
cginparsfgsavithnfsnhwifwvgpfiggalavliydfila
Timeline for d1ih5a_: