Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (4 proteins) |
Protein Family B DNA polymerase [56680] (7 species) |
Species Bacteriophage RB69 [TaxId:12353] [56681] (15 PDB entries) |
Domain d1ig9a2: 1ig9 A:376-901 [62368] Other proteins in same PDB: d1ig9a1 complexed with ca, doc, ttp; mutant |
PDB Entry: 1ig9 (more details), 2.6 Å
SCOP Domain Sequences for d1ig9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig9a2 e.8.1.1 (A:376-901) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]} qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmf
Timeline for d1ig9a2: