Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.1: Calbindin D9K [47474] (2 proteins) made of two EF-hands only |
Protein Calbindin D9K [47475] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries) Uniprot P02633 |
Domain d1ig5a_: 1ig5 A: [62363] complexed with mg |
PDB Entry: 1ig5 (more details), 1.5 Å
SCOPe Domain Sequences for d1ig5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig5a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge vsfeefqvlvkkisq
Timeline for d1ig5a_: