Lineage for d1ig4a_ (1ig4 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016572Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1016573Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 1016587Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)
  6. 1016593Protein Methylation-dependent transcriptional repressor MBD1/PCM1 [54181] (1 species)
  7. 1016594Species Human (Homo sapiens) [TaxId:9606] [54182] (2 PDB entries)
  8. 1016595Domain d1ig4a_: 1ig4 A: [62362]
    complex with methylated DNA
    protein/DNA complex

Details for d1ig4a_

PDB Entry: 1ig4 (more details)

PDB Description: solution structure of the methyl-cpg-binding domain of human mbd1 in complex with methylated dna
PDB Compounds: (A:) Methyl-CpG Binding Protein

SCOPe Domain Sequences for d1ig4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig4a_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]}
maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
lfdfkqgilcypapk

SCOPe Domain Coordinates for d1ig4a_:

Click to download the PDB-style file with coordinates for d1ig4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ig4a_: