![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.10: DNA-binding domain [54170] (1 superfamily) |
![]() | Superfamily d.10.1: DNA-binding domain [54171] (3 families) ![]() |
![]() | Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins) |
![]() | Protein Methylation-dependent transcriptional repressor MBD1/PCM1 [54181] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54182] (2 PDB entries) |
![]() | Domain d1ig4a_: 1ig4 A: [62362] |
PDB Entry: 1ig4 (more details)
SCOP Domain Sequences for d1ig4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig4a_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens)} maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt lfdfkqgilcypapk
Timeline for d1ig4a_: