![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156 |
![]() | Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) ![]() |
![]() | Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein) |
![]() | Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64002] (2 PDB entries) |
![]() | Domain d1ig3b2: 1ig3 B:21-178 [62361] Other proteins in same PDB: d1ig3a1, d1ig3a3, d1ig3b1 complexed with so4, vib |
PDB Entry: 1ig3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ig3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig3b2 c.100.1.1 (B:21-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} mehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadgganhlydlteger esflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqrkieekelqvd vivtlgglggrfdqimasvntlfqathitpvpiiiiqk
Timeline for d1ig3b2: