Lineage for d1ig3b2 (1ig3 B:21-178)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128625Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)
  4. 128626Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) (S)
  5. 128627Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)
  6. 128628Protein Thiamin pyrophosphokinase, catalytic domain [64001] (2 species)
  7. 128632Species Mouse (Mus musculus) [TaxId:10090] [64002] (1 PDB entry)
  8. 128634Domain d1ig3b2: 1ig3 B:21-178 [62361]
    Other proteins in same PDB: d1ig3a1, d1ig3b1

Details for d1ig3b2

PDB Entry: 1ig3 (more details), 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin

SCOP Domain Sequences for d1ig3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig3b2 c.100.1.1 (B:21-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus)}
mehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadgganhlydlteger
esflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqrkieekelqvd
vivtlgglggrfdqimasvntlfqathitpvpiiiiqk

SCOP Domain Coordinates for d1ig3b2:

Click to download the PDB-style file with coordinates for d1ig3b2.
(The format of our PDB-style files is described here.)

Timeline for d1ig3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ig3b1