SCOP 1.57: Domain d1ig3b2: 1ig3 B:21-178

Lineage for d1ig3b2 (1ig3 B:21-178)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)

4. Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family)

5. Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)

6. Protein Thiamin pyrophosphokinase, catalytic domain [64001] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64002] (1 PDB entry)

8. Domain d1ig3b2: 1ig3 B:21-178 [62361]
   Other proteins in same PDB: d1ig3a1, d1ig3b1

Details for d1ig3b2

PDB Entry: 1ig3, 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin

SCOP Domain Sequences for d1ig3b2:

Sequence; same for both SEQRES and ATOM records:

>d1ig3b2 c.100.1.1 (B:21-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus)}
mehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadgganhlydlteger
esflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqrkieekelqvd
vivtlgglggrfdqimasvntlfqathitpvpiiiiqk

Timeline for d1ig3b2:

• d1ig3b2 is new in SCOP 1.57
  
• d1ig3b2 appears in SCOP 1.59
  
• d1ig3b2 appears in the current release, SCOPe 2.08