Lineage for d1ig3b1 (1ig3 B:179-263)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082607Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) (S)
  5. 2082608Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)
  6. 2082609Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)
  7. 2082616Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries)
  8. 2082618Domain d1ig3b1: 1ig3 B:179-263 [62360]
    Other proteins in same PDB: d1ig3a2, d1ig3a3, d1ig3b2
    complexed with so4, vib

Details for d1ig3b1

PDB Entry: 1ig3 (more details), 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin
PDB Compounds: (B:) thiamin pyrophosphokinase

SCOPe Domain Sequences for d1ig3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig3b1 b.82.6.1 (B:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts
ntydgsglvtvetdhpllwtmaiks

SCOPe Domain Coordinates for d1ig3b1:

Click to download the PDB-style file with coordinates for d1ig3b1.
(The format of our PDB-style files is described here.)

Timeline for d1ig3b1: