SCOPe 2.08: Domain d1ig3b1: 1ig3 B:179-263

Lineage for d1ig3b1 (1ig3 B:179-263)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family)

5. Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)

6. Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries)

8. Domain d1ig3b1: 1ig3 B:179-263 [62360]
   Other proteins in same PDB: d1ig3a2, d1ig3a3, d1ig3b2
   complexed with so4, vib

Details for d1ig3b1

PDB Entry: 1ig3, 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin

PDB Compounds: (B:) thiamin pyrophosphokinase

SCOPe Domain Sequences for d1ig3b1:

Sequence; same for both SEQRES and ATOM records:

>d1ig3b1 b.82.6.1 (B:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts
ntydgsglvtvetdhpllwtmaiks

Timeline for d1ig3b1:

• d1ig3b1 first appeared in SCOP 1.57
  
• d1ig3b1 appears in SCOPe 2.07