Lineage for d1ig3a2 (1ig3 A:21-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919028Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156
  4. 2919029Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) (S)
  5. 2919030Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)
  6. 2919031Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species)
  7. 2919038Species Mouse (Mus musculus) [TaxId:10090] [64002] (2 PDB entries)
  8. 2919039Domain d1ig3a2: 1ig3 A:21-178 [62359]
    Other proteins in same PDB: d1ig3a1, d1ig3a3, d1ig3b1
    complexed with so4, vib

Details for d1ig3a2

PDB Entry: 1ig3 (more details), 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin
PDB Compounds: (A:) thiamin pyrophosphokinase

SCOPe Domain Sequences for d1ig3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig3a2 c.100.1.1 (A:21-178) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
mehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadgganhlydlteger
esflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqrkieekelqvd
vivtlgglggrfdqimasvntlfqathitpvpiiiiqk

SCOPe Domain Coordinates for d1ig3a2:

Click to download the PDB-style file with coordinates for d1ig3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ig3a2: