Lineage for d1ig3a1 (1ig3 A:179-263)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63813Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) (S)
  5. 63814Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)
  6. 63815Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (2 species)
  7. 63819Species Mouse (Mus musculus) [TaxId:10090] [63865] (1 PDB entry)
  8. 63820Domain d1ig3a1: 1ig3 A:179-263 [62358]
    Other proteins in same PDB: d1ig3a2, d1ig3b2

Details for d1ig3a1

PDB Entry: 1ig3 (more details), 1.9 Å

PDB Description: Mouse Thiamin Pyrophosphokinase Complexed with Thiamin

SCOP Domain Sequences for d1ig3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig3a1 b.82.6.1 (A:179-263) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus)}
dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts
ntydgsglvtvetdhpllwtmaiks

SCOP Domain Coordinates for d1ig3a1:

Click to download the PDB-style file with coordinates for d1ig3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ig3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ig3a2