SCOPe 2.04: Domain d1ig0b1: 1ig0 B:224-319

Lineage for d1ig0b1 (1ig0 B:224-319)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family)

5. Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)

6. Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63866] (1 PDB entry)

8. Domain d1ig0b1: 1ig0 B:224-319 [62356]
   Other proteins in same PDB: d1ig0a2, d1ig0b2
   complexed with vib

Details for d1ig0b1

PDB Entry: 1ig0, 1.8 Å

PDB Description: crystal structure of yeast thiamin pyrophosphokinase

PDB Compounds: (B:) thiamin pyrophosphokinase

SCOPe Domain Sequences for d1ig0b1:

Sequence; same for both SEQRES and ATOM records:

>d1ig0b1 b.82.6.1 (B:224-319) Thiamin pyrophosphokinase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdliflikkngtlieydpqfrntcigncgllpigeatlvketrglkwdvknwptsvvtgr
vsssnrfvgdnccfidtkddiilnveifvdklidfl

Timeline for d1ig0b1:

• d1ig0b1 first appeared in SCOP 1.57
  
• d1ig0b1 appears in SCOPe 2.03
  
• d1ig0b1 appears in SCOPe 2.05
  
• d1ig0b1 appears in the current release, SCOPe 2.08