SCOP 1.57: Domain d1ig0a1: 1ig0 A:224-319

Lineage for d1ig0a1 (1ig0 A:224-319)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family)

5. Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)

6. Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63866] (1 PDB entry)

8. Domain d1ig0a1: 1ig0 A:224-319 [62354]
   Other proteins in same PDB: d1ig0a2, d1ig0b2

Details for d1ig0a1

PDB Entry: 1ig0, 1.8 Å

PDB Description: crystal structure of yeast thiamin pyrophosphokinase

SCOP Domain Sequences for d1ig0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ig0a1 b.82.6.1 (A:224-319) Thiamin pyrophosphokinase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
tdliflikkngtlieydpqfrntcigncgllpigeatlvketrglkwdvknwptsvvtgr
vsssnrfvgdnccfidtkddiilnveifvdklidfl

Timeline for d1ig0a1:

• d1ig0a1 is new in SCOP 1.57
  
• d1ig0a1 appears in SCOP 1.59
  
• d1ig0a1 appears in the current release, SCOPe 2.08