Lineage for d1ig0a1 (1ig0 A:224-319)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2406108Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) (S)
  5. 2406109Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)
  6. 2406110Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)
  7. 2406111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63866] (1 PDB entry)
  8. 2406112Domain d1ig0a1: 1ig0 A:224-319 [62354]
    Other proteins in same PDB: d1ig0a2, d1ig0b2
    complexed with vib

Details for d1ig0a1

PDB Entry: 1ig0 (more details), 1.8 Å

PDB Description: crystal structure of yeast thiamin pyrophosphokinase
PDB Compounds: (A:) thiamin pyrophosphokinase

SCOPe Domain Sequences for d1ig0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig0a1 b.82.6.1 (A:224-319) Thiamin pyrophosphokinase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdliflikkngtlieydpqfrntcigncgllpigeatlvketrglkwdvknwptsvvtgr
vsssnrfvgdnccfidtkddiilnveifvdklidfl

SCOPe Domain Coordinates for d1ig0a1:

Click to download the PDB-style file with coordinates for d1ig0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ig0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ig0a2