Lineage for d1ifqa_ (1ifq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922955Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1922956Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins)
  6. 1922957Protein Sec22b [64358] (1 species)
  7. 1922958Species Mouse (Mus musculus) [TaxId:10090] [64359] (1 PDB entry)
  8. 1922959Domain d1ifqa_: 1ifq A: [62350]
    complexed with gol

Details for d1ifqa_

PDB Entry: 1ifq (more details), 2.4 Å

PDB Description: Sec22b N-terminal domain
PDB Compounds: (A:) vesicle trafficking protein Sec22b

SCOPe Domain Sequences for d1ifqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus) [TaxId: 10090]}
svlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamt
fhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiq
ktkklyi

SCOPe Domain Coordinates for d1ifqa_:

Click to download the PDB-style file with coordinates for d1ifqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ifqa_: