Lineage for d1ifqa_ (1ifq A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136761Fold d.110: Profilin-like [55769] (4 superfamilies)
  4. 136846Superfamily d.110.4: Synatpobrevin N-terminal domain [64356] (1 family) (S)
  5. 136847Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (2 proteins)
  6. 136848Protein Sec22b [64358] (1 species)
  7. 136849Species Mouse (Mus musculus) [TaxId:10090] [64359] (1 PDB entry)
  8. 136850Domain d1ifqa_: 1ifq A: [62350]

Details for d1ifqa_

PDB Entry: 1ifq (more details), 2.4 Å

PDB Description: Sec22b N-terminal domain

SCOP Domain Sequences for d1ifqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus)}
svlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamt
fhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiq
ktkklyi

SCOP Domain Coordinates for d1ifqa_:

Click to download the PDB-style file with coordinates for d1ifqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ifqa_: