Class b: All beta proteins [48724] (177 folds) |
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) automatically mapped to Pfam PF03974 |
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
Protein Ecotin, trypsin inhibitor [49774] (1 species) |
Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
Domain d1ifga_: 1ifg A: [62349] a monomeric form |
PDB Entry: 1ifg (more details), 2 Å
SCOPe Domain Sequences for d1ifga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifga_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle gwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv kyrvwadgkaeekidnavvr
Timeline for d1ifga_: