Lineage for d1ieca_ (1iec A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062283Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2062284Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2062285Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 protein domains)
  6. 2062294Protein Human cytomegalovirus protease [50791] (1 species)
  7. 2062295Species Human cytomegalovirus [TaxId:10359] [50792] (15 PDB entries)
  8. 2062302Domain d1ieca_: 1iec A: [62319]
    mutant

Details for d1ieca_

PDB Entry: 1iec (more details), 2.2 Å

PDB Description: crystal structure of the catalytic site mutant (h157a) of the human cytomegalovirus protease
PDB Compounds: (A:) capsid protein p40: assemblin protease

SCOPe Domain Sequences for d1ieca_:

Sequence, based on SEQRES records: (download)

>d1ieca_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]}
avapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalplninhddtavv
ghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsya
glslssrrcddveqatslsgsettpfkavalcsvgrrrgtlavygrdpewvtqrfpdlta
adrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklrydkqlvgvte
resyvka

Sequence, based on observed residues (ATOM records): (download)

>d1ieca_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]}
avapvyvggflarydqspdeaelllprdvvehwlalplninhddtavvghvaamqsvrdg
lfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslssrfkava
lcsvgrrrgtlavygrdpewvtqrfpdltaadrdglraqwqgdpfrsdsygllgnsvdal
yirerlpklrydkqlvgvteresyvka

SCOPe Domain Coordinates for d1ieca_:

Click to download the PDB-style file with coordinates for d1ieca_.
(The format of our PDB-style files is described here.)

Timeline for d1ieca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iecb_